Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

WWP2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP153089 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP153089 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP153089 Supplier Novus Biologicals Supplier No. NBP153089

Rabbit Polyclonal Antibody

WWP2 Polyclonal specifically detects WWP2 in Human samples. It is validated for Western Blot.

Specifications

Antigen WWP2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS & 2% Sucrose. with 0.09% Sodium Azide
Gene Accession No. O00308
Gene Alias AIP2Nedd-4-like ubiquitin-protein ligase, atrophin-1 interacting protein 2, Atrophin-1-interacting protein 2, EC 6.3.2, EC 6.3.2.-, NEDD4-like E3 ubiquitin-protein ligase WWP2, WW domain containing E3 ubiquitin protein ligase 2, WW domain-containing protein 2, WWp2-like
Gene Symbols WWP2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to WWP2(WW domain containing E3 ubiquitin protein ligase 2) The peptide sequence was selected from the middle region of WWP2. Peptide sequence SSASTDHDPLGPLPPGWEKRQDNGRVYYVNHNTRTTQWEDPRTQGMIQEP.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 11060
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 100%; Chicken: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.