Xanthine Oxidase Rabbit anti-Human, Mouse, Rat, Clone: 0M8E7, Novus Biologicals™

Rabbit Monoclonal Antibody

Supplier:  Novus Biologicals NBP31673520UL

Catalog No. NB168562

Description

Xanthine Oxidase Monoclonal antibody specifically detects Xanthine Oxidase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Xanthine Oxidase
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, 0.05% BSA, 50% glycerol, pH7.3
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Form: Purified

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Clone: 0M8E7
• Dilution: Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin
• Gene Alias: EC 1.17.1.4, EC 1.7.2.2, xanthene dehydrogenase, xanthine dehydrogenase, xanthine dehydrogenase/oxidase, xanthine oxidase, xanthine oxidoreductase, XDHA, XO, XOR
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 202-293 of human Xanthine Oxidase (XDH) (P47989). TPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQASTLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHG
• Quantity: 20 μg
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 7498
• Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
• Isotype: IgG