Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Xanthine Oxidase Rabbit anti-Human, Mouse, Rat, Clone: 0M8E7, Novus Biologicals™

Rabbit Monoclonal Antibody
$206.50 - $492.50
Specifications
Antigen | Xanthine Oxidase |
---|---|
Clone | 0M8E7 |
Dilution | Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin |
Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Monoclonal |
Description
Xanthine Oxidase Monoclonal antibody specifically detects Xanthine Oxidase in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
Xanthine Oxidase | |
Western Blot 1:500 - 1:2000, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunohistochemistry-Paraffin | |
Monoclonal | |
Purified | |
RUO | |
Human, Mouse, Rat | |
EC 1.17.1.4, EC 1.7.2.2, xanthene dehydrogenase, xanthine dehydrogenase, xanthine dehydrogenase/oxidase, xanthine oxidase, xanthine oxidoreductase, XDHA, XO, XOR | |
Recombinant fusion protein containing a sequence corresponding to amino acids 202-293 of human Xanthine Oxidase (XDH) (P47989). TPLDPTQEPIFPPELLRLKDTPRKQLRFEGERVTWIQASTLKELLDLKAQHPDAKLVVGNTEIGIEMKFKNMLFPMIVCPAWIPELNSVEHG | |
Primary | |
Store at -20°C. Avoid freeze-thaw cycles. |
0M8E7 | |
Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Signal Transduction | |
PBS, 0.05% BSA, 50% glycerol, pH7.3 | |
7498 | |
IgG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title