Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. XK X-linked Kx blood group Antibody, Novus Biologicals™

XK X-linked Kx blood group Antibody, Novus Biologicals™
SDP

Catalog No. NBP187828 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP187828 0.1 mL
NB431366 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP187828 Supplier Novus Biologicals Supplier No. NBP187828
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

XK X-linked Kx blood group Polyclonal specifically detects XK X-linked Kx blood group in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen XK X-linked Kx blood group
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias Kell blood group precursor (McLeod phenotype), Kell complex 37 kDa component, KX, Kx antigen, membrane transport protein XK, X1k, XK, Kell blood group complex subunit (McLeod syndrome), XKR1XK-related protein 1, X-linked Kx blood group (McLeod syndrome), XRG1
Gene Symbols XK
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:DLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSRA
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Research Discipline Neuroscience
Primary or Secondary Primary
Gene ID (Entrez) 7504
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.