XK X-linked Kx blood group Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB431366	Novus Biologicals NBP18782825UL	25 μL
NBP187828	Novus Biologicals NBP187828	0.1 mL

Description

XK X-linked Kx blood group Polyclonal specifically detects XK X-linked Kx blood group in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: XK X-linked Kx blood group
• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Alias: Kell blood group precursor (McLeod phenotype), Kell complex 37 kDa component, KX, Kx antigen, membrane transport protein XK, X1k, XK, Kell blood group complex subunit (McLeod syndrome), XKR1XK-related protein 1, X-linked Kx blood group (McLeod syndrome), XRG1
• Gene Symbols: XK
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Neuroscience
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene ID (Entrez): 7504
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DLSRDRPLVLLLHLLQLGPLFRCFEVFCIYFQSGNNEEPYVSITKKRQMPKNGLSEEIEKEVGQAEGKLITHRSAFSRA
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only