Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
XPB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP258758
Description
XPB Polyclonal specifically detects XPB in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
XPB | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 ug/ml | |
Basic transcription factor 2 89 kDa subunit, BTF2, BTF2 p89, DNA excision repair protein ERCC-3, DNA repair protein complementing XP-B cells, EC 3.6.1, EC 3.6.4.12, excision repair cross-complementing rodent repair deficiency, complementationgroup 3 (xeroderma pigmentosum group B complementing), GTF2H, RAD25, TFIIH, TFIIH basal transcription factor complex 89 kDa subunit, TFIIH basal transcription factor complex helicase XPB subunit, TFIIH p89, Xeroderma pigmentosum group B-complementing protein, xeroderma pigmentosum, complementation group B, XPBC, XPBTFIIH 89 kDa subunit | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
ERCC3 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEE | |
100 μL | |
Cancer, DNA Repair, Nucleotide Excision Repair | |
2071 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction