XPB Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NBP258758	Novus Biologicals NBP258758	100 μL
NB393290	Novus Biologicals NBP25875825UL	25 μL

Description

XPB Polyclonal specifically detects XPB in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: XPB
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Cancer, DNA Repair, Nucleotide Excision Repair
• Gene Alias: Basic transcription factor 2 89 kDa subunit, BTF2, BTF2 p89, DNA excision repair protein ERCC-3, DNA repair protein complementing XP-B cells, EC 3.6.1, EC 3.6.4.12, excision repair cross-complementing rodent repair deficiency, complementationgroup 3 (xeroderma pigmentosum group B complementing), GTF2H, RAD25, TFIIH, TFIIH basal transcription factor complex 89 kDa subunit, TFIIH basal transcription factor complex helicase XPB subunit, TFIIH p89, Xeroderma pigmentosum group B-complementing protein, xeroderma pigmentosum, complementation group B, XPBC, XPBTFIIH 89 kDa subunit
• Gene Symbols: ERCC3
• Isotype: IgG
• Purification Method: Affinity Purified

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene ID (Entrez): 2071
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KLCTVSYGKVKLVLKHNRYFVESCHPDVIQHLLQDPVIRECRLRNSEGEATELITETFTSKSAISKTAESSGGPSTSRVTDPQGKSDIPMDLFDFYEQMDKDEEEEE
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only