Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

XPV/DNA polymerase eta Antibody, Novus Biologicals™
SDP

Catalog No. NB406193 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB406193 25 μL
NBP187166 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB406193 Supplier Novus Biologicals Supplier No. NBP18716625UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

XPV/DNA polymerase eta Polyclonal specifically detects XPV/DNA polymerase eta in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen XPV/DNA polymerase eta
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. Q9Y253
Gene Alias DNA polymerase eta, EC 2.7.7.7, polymerase (DNA directed), eta, RAD30, RAD30 homolog A, RAD30AFLJ16395, Xeroderma pigmentosum variant type protein, XP-V, XPVFLJ21978
Gene Symbols POLH
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:ERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGSVPQLFSQMPIRKIRSL
Molecular Weight of Antigen 78 kDa
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline DNA Polymerases, DNA Repair
Primary or Secondary Primary
Gene ID (Entrez) 5429
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.