XTP3TPA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP155335

Catalog No. NBP155335

Description

XTP3TPA Polyclonal specifically detects XTP3TPA in Human samples. It is validated for Western Blot.

Specifications

• Antigen: XTP3TPA
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: dCTP pyrophosphatase 1, dCTPase 1, Deoxycytidine-triphosphatase 1, EC 3.6.1.12, MGC5627, RS21C6XTP3-transactivated gene A protein, XTP3TPACDA03, XTP3-transactivated protein A
• Host Species: Rabbit
• Molecular Weight of Antigen: 19 kDa
• Quantity: 100 μL
• Research Discipline: Proteases & Other Enzymes
• Gene ID (Entrez): 79077
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9H773
• Gene Symbols: DCTPP1
• Immunogen: Synthetic peptides corresponding to XTP3TPA(XTP3-transactivated protein A) The peptide sequence was selected from the N terminal of XTP3TPA. Peptide sequence MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQF.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG