XTP4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23414225UL

Catalog No. NB404748

Description

XTP4 Polyclonal specifically detects XTP4 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: XTP4
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Accession No.: Q9BRT3
• Gene Symbols: MIEN1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: GTGAFEIEINGQLVFSKLENGGFPYEKDLIEAIRRASNGETLEKITNSRP
• Quantity: 25 μL
• Research Discipline: Cancer
• Gene ID (Entrez): 84299
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C35, chromosome 17 open reading frame 37, HBV XAg-transactivated protein 4, HBV X-transactivated gene 4 protein, MGC14832, ORB3, protein C17orf37, Protein C35, XTP4RDX12
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only