Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
YAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23843025UL
Description
YAP1 Polyclonal specifically detects YAP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
YAP1 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
P46937 | |
YAP1 | |
This YAP1 antibody was developed against a recombinant protein corresponding to amino acids: PRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLD | |
25 μL | |
Breast Cancer, Cancer, Chromatin Research, Core ESC Like Genes, Signal Transduction, Stem Cell Markers, Transcription Factors and Regulators, Tyrosine Kinases | |
10413 | |
Human | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
65 kDa Yes-associated protein, COB1, Protein Yorkie Homolog, Transcriptional Coactivator YAP1, YAP, YAP1-2gamma, YAP2, YAP2L, YAP65, YAP65yes-associated protein 2, Yes Associated Protein, Yes-Associated Protein, Yes-associated protein 1, Yes-associated protein 1, 65kDa, yes-associated protein beta, yes-associated protein delta, Yes-Associated Protein YAP65 Homolog, YKI, yorkie homolog | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Based on the immunogen sequence, the expected cross reactivity for this YAP1 antibody would be for isotype 2, 4, 8 and 9. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction