YAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB436212	Novus Biologicals NBP23843025UL	25 μL
NBP238430	Novus Biologicals NBP238430	0.1 mL

Description

YAP1 Polyclonal specifically detects YAP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: YAP1
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human
• Gene Accession No.: P46937
• Gene ID (Entrez): 10413
• Immunogen: This YAP1 antibody was developed against a recombinant protein corresponding to amino acids: PRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLD
• Primary or Secondary: Primary
• Test Specificity: Based on the immunogen sequence, the expected cross reactivity for this YAP1 antibody would be for isotype 2, 4, 8 and 9.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Breast Cancer, Cancer, Chromatin Research, Core ESC Like Genes, Signal Transduction, Stem Cell Markers, Transcription Factors and Regulators, Tyrosine Kinases
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 65 kDa Yes-associated protein, COB1, Protein Yorkie Homolog, Transcriptional Coactivator YAP1, YAP, YAP1-2gamma, YAP2, YAP2L, YAP65, YAP65yes-associated protein 2, Yes Associated Protein, Yes-Associated Protein, Yes-associated protein 1, Yes-associated protein 1, 65kDa, yes-associated protein beta, yes-associated protein delta, Yes-Associated Protein YAP65 Homolog, YKI, yorkie homolog
• Gene Symbols: YAP1
• Isotype: IgG
• Purification Method: Affinity Purified