YAP1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238430

Catalog No. NBP238430

Description

YAP1 Polyclonal specifically detects YAP1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: YAP1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P46937
• Gene Symbols: YAP1
• Immunogen: This YAP1 antibody was developed against a recombinant protein corresponding to amino acids: PRKAMLSQMNVTAPTSPPVQQNMMNSASGPLPDGWEQAMTQDGEIYYINHKNKTTSWLD
• Quantity: 0.1 mL
• Research Discipline: Breast Cancer, Cancer, Chromatin Research, Core ESC Like Genes, Signal Transduction, Stem Cell Markers, Transcription Factors and Regulators, Tyrosine Kinases
• Gene ID (Entrez): 10413
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 65 kDa Yes-associated protein, COB1, Protein Yorkie Homolog, Transcriptional Coactivator YAP1, YAP, YAP1-2gamma, YAP2, YAP2L, YAP65, YAP65yes-associated protein 2, Yes Associated Protein, Yes-Associated Protein, Yes-associated protein 1, Yes-associated protein 1, 65kDa, yes-associated protein beta, yes-associated protein delta, Yes-Associated Protein YAP65 Homolog, YKI, yorkie homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Based on the immunogen sequence, the expected cross reactivity for this YAP1 antibody would be for isotype 2, 4, 8 and 9.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.