YB1 Antibody, Novus Biologicals™

Catalog No.	Quantity
NB393623	25 μL
NBP258086	100 μL

Catalog No. NB393623 Supplier Novus Biologicals Supplier No. NBP25808625UL

Description

Rabbit Polyclonal Antibody

YB1 Polyclonal specifically detects YB1 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: YB1
• Applications: Immunocytochemistry, Immunofluorescence
• Classification: Polyclonal
• Conjugate: Unconjugated
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Formulation: PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: BP-8, CBF-A, class II, Y box-binding protein I, CSDA2, CSDB, DBPB CCAAT-binding transcription factor I subunit A, EFI-A, Enhancer factor I subunit A, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP1 Y-box-binding protein 1, nuclease-sensitive element-binding protein 1, Y box binding protein 1, YB1 DNA-binding protein B, YB-1 Y-box transcription factor, YBX1
• Gene Symbols: YBX1
• Host Species: Rabbit
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQ
• Purification Method: Affinity Purified
• Quantity: 25 μL
• Regulatory Status: RUO
• Research Discipline: Breast Cancer, Cancer, DNA Repair, Epigenetics, Ovarian Carcinoma Cell Markers, Stem Cell Markers, Transcription Factors and Regulators, Translation Control
• Primary or Secondary: Primary
• Gene ID (Entrez): 4904
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Target Species: Human
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

For Research Use Only