Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. YB1 Rabbit anti-Human, Mouse, Rat, Clone: 9J7M4, Novus Biologicals™

YB1 Rabbit anti-Human, Mouse, Rat, Clone: 9J7M4, Novus Biologicals™
SDP

Catalog No. NB167517 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μg
20 μg
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB167517 100 μg
NB167518 20 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
This item is not returnable. View return policy
Catalog No. NB167517 Supplier Novus Biologicals Supplier No. NBP316213100UL
Add to Cart
Add to Cart
This item is not returnable. View return policy

Description

Rabbit Monoclonal Antibody

YB1 Monoclonal antibody specifically detects YB1 in Human, Mouse, Rat samples. It is validated for Western Blot, ChIP assay, Immunohistochemistry, Immunofluorescence, Immunoprecipitation, Immunohistochemistry (Paraffin)

Specifications

Antigen YB1
Applications ChIP Assay, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin), Immunoprecipitation
Classification Monoclonal
Clone 9J7M4
Conjugate Unconjugated
Dilution Western Blot 1:500 - 1:2000, Chromatin Immunoprecipitation 1:50 - 1:200, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1:50 - 1:200, Immunoprecipitation 1:50 - 1:200, Immunohistochemistry-Paraffin
Formulation PBS, 0.05% BSA, 50% glycerol, pH7.3
Gene Alias BP-8, CBF-A, class II, Y box-binding protein I, CSDA2, CSDB, DBPB CCAAT-binding transcription factor I subunit A, EFI-A, Enhancer factor I subunit A, MDR-NF1, MGC104858, MGC110976, MGC117250, NSEP1 Y-box-binding protein 1, nuclease-sensitive element-binding protein 1, Y box binding protein 1, YB1 DNA-binding protein B, YB-1 Y-box transcription factor, YBX1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence within amino acids 225-324 of human YB1 (P67809). GAGEQGRPVRQNMYRGYRPRFRRGPPRQRQPREDGNEEDKENQGDETQGQQPPQRRYRRNFNYRRRRPENPKPQDGKETKAADPPAENSSAPEAEQGGAE
Purification Method Affinity purified
Quantity 100 μg
Regulatory Status RUO
Research Discipline Breast Cancer, Cancer, DNA Repair, Epigenetics, Ovarian Carcinoma Cell Markers, Stem Cell Markers, Transcription Factors and Regulators, Translation Control
Primary or Secondary Primary
Gene ID (Entrez) 4904
Target Species Human, Mouse, Rat
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.