Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZACN Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18010420UL

 View more versions of this product

Catalog No. NBP18010420


Only null left
Add to Cart

Description

Description

ZACN Polyclonal specifically detects ZACN in Human samples. It is validated for Western Blot.
Specifications

Specifications

ZACN
Polyclonal
Western Blot 1:1000
NP_851321
ZACN
Synthetic peptide directed towards the N terminal of human LGICZ1. Peptide sequence PSLFNVNLSKKVQESIQIPNNGSAPLLVDVRVFVSNVFNVDILRYTMSSM.
20 μL
Primary
Human
IgG
Western Blot
Unconjugated
PBS & 2% Sucrose. with No Preservative
L2, LGICZ1, ligand-gated ion channel subunit, ligand-gated ion channel, zinc activated 1, ligand-gated ion-channel receptor L2, MGC129841, ZAC, ZAC1, zinc activated ligand-gated ion channel, zinc activated ligand-gated ion channel 1, zinc-activated ligand-gated ion channel
Rabbit
Affinity Purified
RUO
353174
Store at -20C. Avoid freeze-thaw cycles.
Product Suggestions

Product Suggestions

Videos
SDS
Documents

Documents

Product Certifications
Promotions

Promotions

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.