Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZBED6 C-Terminal Like Antibody, Novus Biologicals™
SDP

Catalog No. NBP156604 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156604 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156604 Supplier Novus Biologicals Supplier No. NBP156604

Rabbit Polyclonal Antibody

ZBED6 C-Terminal Like Polyclonal specifically detects ZBED6 C-Terminal Like in Human samples. It is validated for Western Blot.

Specifications

Antigen C7orf29
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96FA7
Gene Alias chromosome 7 open reading frame 29, hypothetical protein LOC113763
Gene Symbols C7ORF29
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C7ORF29 The peptide sequence was selected from the middle region of C7ORF29. Peptide sequence VKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSH.
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 113763
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.