Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZBED6 C-Terminal Like Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$464.00
Specifications
| Antigen | C7orf29 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZBED6 C-Terminal Like Polyclonal specifically detects ZBED6 C-Terminal Like in Human samples. It is validated for Western Blot.Specifications
| C7orf29 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| Q96FA7 | |
| 113763 | |
| Synthetic peptides corresponding to C7ORF29 The peptide sequence was selected from the middle region of C7ORF29. Peptide sequence VKEIRVSEYSLNSPSPLQSPRGLCVDPTRVAKSSGVEGRSQGEPLQSSSH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| chromosome 7 open reading frame 29, hypothetical protein LOC113763 | |
| C7ORF29 | |
| IgG | |
| Affinity Purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title