Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZBTB22 Antibody, Novus Biologicals™

ZBTB22 Antibody, Novus Biologicals™
SDP

Catalog No. NB8011320UL Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB8011320UL 20 μL
NBP180113 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB8011320UL Supplier Novus Biologicals Supplier No. NBP18011320UL

Description

Rabbit Polyclonal Antibody

ZBTB22 Polyclonal specifically detects ZBTB22 in Human samples. It is validated for Western Blot.

Specifications

Antigen ZBTB22
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_005444
Gene Alias BING1ZNF297, fru, fruitless, Protein BING1, ZBTB22AZNF297A, zinc finger and BTB domain containing 22, zinc finger and BTB domain-containing protein 22, Zinc finger protein 297Zinc finger and BTB domain-containing protein 22A
Gene Symbols ZBTB22
Host Species Rabbit
Immunogen Synthetic peptide directed towards the C terminal of human ZBTB22. Peptide sequence MQGNQILVFPSSSSSSSSQAPGQPPGNQAEHGAVTVGGTSVGSLGVPGSV.
Molecular Weight of Antigen 66 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 9278
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.