Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZBTB38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180263
Description
ZBTB38 Polyclonal specifically detects ZBTB38 in Mouse samples. It is validated for Western Blot.Specifications
| ZBTB38 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| CIBZ, FLJ22332, FLJ31131, FLJ35036, zinc finger and BTB domain containing 38, zinc finger and BTB domain-containing protein 38, ZNF921 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 253461 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_780746 | |
| ZBTB38 | |
| Synthetic peptide directed towards the N terminal of human ZBTB38. Peptide sequence EDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFS. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Mouse: 100%; Bovine: 92%; Equine: 92%; Human: 92%; Pig: 92%; Chicken: 78%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction