Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZBTB38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZBTB38 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZBTB38 Polyclonal specifically detects ZBTB38 in Mouse samples. It is validated for Western Blot.Specifications
ZBTB38 | |
Polyclonal | |
Rabbit | |
NP_780746 | |
253461 | |
Synthetic peptide directed towards the N terminal of human ZBTB38. Peptide sequence EDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
CIBZ, FLJ22332, FLJ31131, FLJ35036, zinc finger and BTB domain containing 38, zinc finger and BTB domain-containing protein 38, ZNF921 | |
ZBTB38 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title