Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZBTB38 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | ZBTB38 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZBTB38 Polyclonal specifically detects ZBTB38 in Mouse samples. It is validated for Western Blot.Specifications
| ZBTB38 | |
| Polyclonal | |
| Rabbit | |
| NP_780746 | |
| 253461 | |
| Synthetic peptide directed towards the N terminal of human ZBTB38. Peptide sequence EDLSDRNFSNSPGPYVVCITEKGVVKEEKNEKRHEEPAVTNGPRITNAFS. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| CIBZ, FLJ22332, FLJ31131, FLJ35036, zinc finger and BTB domain containing 38, zinc finger and BTB domain-containing protein 38, ZNF921 | |
| ZBTB38 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title