Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZBTB7A/Pokemon Antibody, Novus Biologicals™

ZBTB7A/Pokemon Antibody, Novus Biologicals™
SDP

Catalog No. NB396770 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB396770 25 μL
NBP238550 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB396770 Supplier Novus Biologicals Supplier No. NBP23855025UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ZBTB7A/Pokemon Polyclonal specifically detects ZBTB7A/Pokemon in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen ZBTB7A/Pokemon
Applications Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunocytochemistry/Immunofluorescence 0.25-2 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. O95365
Gene Alias DKFZp547O146, Factor binding IST protein 1, Factor that binds to inducer of short transcripts protein 1, FBI-1POK erythroid myeloid ontogenic factor, FBI1TTF-I-interacting peptide 21, HIV-1 inducer of short transcripts binding protein, Leukemia/lymphoma-related factor, LRFHIV-1 1st-binding protein 1, lymphoma related factor, MGC99631, pokemon, TIP21, ZBTB7zinc finger and BTB domain containing 7, zinc finger and BTB domain containing 7A, zinc finger and BTB domain containing 7A, HIV-1 inducer of short transcriptsbinding protein, zinc finger and BTB domain-containing protein 7A, Zinc finger protein 857A, ZNF857APOZ and Krueppel erythroid myeloid ontogenic factor
Gene Symbols ZBTB7A
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: AVSHVCADLLDRQILAADAGADAGQLDLVDQIDQRNLLRAKEYLEFFQSN
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Cancer, Transcription Factors and Regulators
Primary or Secondary Primary
Gene ID (Entrez) 51341
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.