Learn More
Description
Specifications
Specifications
| Antigen | ZCCHC17 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulation | PBS (pH 7.2) and 40% Glycerol |
| Gene Alias | HSPC251, nucleolar protein of 40 kDa, Pnn-interacting nucleolar protein, pNO40nucleolar protein 40, PS1D protein, PS1DRP11-266K22.1, putative S1 RNA binding domain protein, Putative S1 RNA-binding domain protein, Zinc finger CCHC domain-containing protein 17, zinc finger, CCHC domain containing 17 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: MNSGRPETMENLPALYTIFQGEVAMVTDYGAFIKIPGCRKQGLVHRTHMSSCRVDKPSEIVDVGDKVWVKLIGREMK |
| Purification Method | Protein A purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
