Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZCCHC24 Antibody, Novus Biologicals™

ZCCHC24 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15643720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15643720 20 μL
NBP156437 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15643720 Supplier Novus Biologicals Supplier No. NBP15643720UL

Description

Rabbit Polyclonal Antibody

ZCCHC24 Polyclonal specifically detects ZCCHC24 in Human samples. It is validated for Western Blot.

Specifications

Antigen ZCCHC24
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8N2G6
Gene Alias C10orf56, chromosome 10 open reading frame 56, FLJ90798, zinc finger CCHC domain-containing protein 24, zinc finger, CCHC domain containing 24
Gene Symbols ZCCHC24
Host Species Rabbit
Immunogen Synthetic peptides corresponding to C10ORF56 The peptide sequence was selected from the middle region of C10ORF56. Peptide sequence LTEHFSDLTLTSEARKPSKRPPPNYLCHLCFNKGHYIKDCPQARPKGEGL.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 219654
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.