Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZDHHC13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159026
Description
ZDHHC13 Polyclonal specifically detects ZDHHC13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ZDHHC13 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
DHHC-13, EC 2.3.1, EC 2.3.1.-, FLJ10852, FLJ10941, HIP14LHIP14-related protein, HIP3RP, huntingtin interacting protein HIP3RP, Huntingtin-interacting protein 14-related protein, Huntingtin-interacting protein HIP3RP, MGC64994, palmitoyltransferase ZDHHC13, probable palmitoyltransferase ZDHHC13, Putative MAPK-activating protein PM03, Putative NF-kappa-B-activating protein 209, Zinc finger DHHC domain-containing protein 13, zinc finger, DHHC domain containing 13, zinc finger, DHHC-type containing 13 | |
Rabbit | |
Protein A purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Mouse: 100%; Rat: 100%; Canine: 92%; Equine: 92%; Rabbit: 92%; Chicken: 91%; Bovine: 85%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Yeast, Zebrafish | |
Purified |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
1 mg/ml | |
Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500 | |
Q8IUH4-3 | |
ZDHHC13 | |
Synthetic peptides corresponding to ZDHHC13(zinc finger, DHHC-type containing 13) The peptide sequence was selected from the N terminal of ZDHHC13. Peptide sequence MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV. | |
100 μL | |
Signal Transduction | |
54503 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction