ZDHHC13 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP15902620UL

Catalog No. NBP15902620

Description

ZDHHC13 Polyclonal specifically detects ZDHHC13 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZDHHC13
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: Q8IUH4-3
• Gene Symbols: ZDHHC13
• Immunogen: Synthetic peptides corresponding to ZDHHC13(zinc finger, DHHC-type containing 13) The peptide sequence was selected from the N terminal of ZDHHC13. Peptide sequence MVILLLQHGADPTLIDGEGFSSIHLAVLFQHMPIIAYLISKGQSVNMTDV.
• Quantity: 20 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 54503
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DHHC-13, EC 2.3.1, EC 2.3.1.-, FLJ10852, FLJ10941, HIP14LHIP14-related protein, HIP3RP, huntingtin interacting protein HIP3RP, Huntingtin-interacting protein 14-related protein, Huntingtin-interacting protein HIP3RP, MGC64994, palmitoyltransferase ZDHHC13, probable palmitoyltransferase ZDHHC13, Putative MAPK-activating protein PM03, Putative NF-kappa-B-activating protein 209, Zinc finger DHHC domain-containing protein 13, zinc finger, DHHC domain containing 13, zinc finger, DHHC-type containing 13
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified