Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZDHHC19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP16010020UL
Description
ZDHHC19 Polyclonal specifically detects ZDHHC19 in Human samples. It is validated for Western Blot.Specifications
ZDHHC19 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
B3KVI1 | |
ZDHHC19 | |
Synthetic peptides corresponding to ZDHHC19(zinc finger, DHHC-type containing 19) The peptide sequence was selected from the middle region of ZDHHC19. Peptide sequence AAGLLVPLSLLLLIQALSVSSADRTYKGKCRHLQGYNPFDQGCASNWYLT. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
DHHC domain containing 19, DHHC19, EC 2.3.1.-, zinc finger, DHHC-type containing 19 | |
Rabbit | |
Affinity Purified | |
RUO | |
131540 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction