Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZDHHC2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $646.00
Specifications
Antigen | ZDHHC2 |
---|---|
Dilution | Western Blot Reactivity reported in (PMID: 26214373)., Simple Western 1:20, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ZDHHC2 Polyclonal specifically detects ZDHHC2 in Human, Mouse samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ZDHHC2 | |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
51201 | |
This antibody was developed against a recombinant protein corresponding to the amino acids: KEFHLSYAEKDLLEREPRGEAHQEVLRRAAKDLPIYTRTMSGAIRYCDRCQLI | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Western Blot Reactivity reported in (PMID: 26214373)., Simple Western 1:20, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Human, Mouse | |
DHHC2, DHHC-2, EC 2.3.1, EC 2.3.1.-, palmitoyltransferase ZDHHC2, Ream, REC, Reduced expression associated with metastasis protein, Reduced expression in cancer protein, Zinc finger DHHC domain-containing protein 2, Zinc finger protein 372, zinc finger, DHHC domain containing 2, zinc finger, DHHC-type containing 2, ZNF372rec | |
ZDHHC2 | |
IgG | |
Affinity Purified | |
Specificity of human ZDHHC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title