ZDHHC21 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157049

Catalog No. NBP157049

Description

ZDHHC21 Polyclonal specifically detects ZDHHC21 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZDHHC21
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: ZDHHC21
• Immunogen: Synthetic peptides corresponding to ZDHHC21 (zinc finger, DHHC-type containing 21) The peptide sequence was selected from the middle region of ZDHHC21. Peptide sequence ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 340481
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: DHHC-21, DNZ1, EC 2.3.1, EC 2.3.1.-, HSPC097, probable palmitoyltransferase ZDHHC21, Zinc finger DHHC domain-containing protein 21, zinc finger, DHHC domain containing 21, zinc finger, DHHC-type containing 21,9130404H11Rik
• Host Species: Rabbit
• Molecular Weight of Antigen: 31 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Canine: 92%; Rabbit: 92%; Rat: 85%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Primate, Rabbit
• Isotype: IgG