Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZDHHC21 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$499.50
Specifications
| Antigen | ZDHHC21 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP157049
|
Novus Biologicals
NBP157049 |
100 μL |
Each for $499.50
|
|
|||||
|
NBP15704920
|
Novus Biologicals
NBP15704920UL |
20 μL | N/A | N/A | N/A | ||||
Description
ZDHHC21 Polyclonal specifically detects ZDHHC21 in Human samples. It is validated for Western Blot.Specifications
| ZDHHC21 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| 340481 | |
| Synthetic peptides corresponding to ZDHHC21 (zinc finger, DHHC-type containing 21) The peptide sequence was selected from the middle region of ZDHHC21. Peptide sequence ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV. | |
| Primary | |
| 31 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DHHC-21, DNZ1, EC 2.3.1, EC 2.3.1.-, HSPC097, probable palmitoyltransferase ZDHHC21, Zinc finger DHHC domain-containing protein 21, zinc finger, DHHC domain containing 21, zinc finger, DHHC-type containing 21,9130404H11Rik | |
| ZDHHC21 | |
| IgG | |
| Store at -20C. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title