Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZDHHC21 Antibody, Novus Biologicals™

ZDHHC21 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15704920 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15704920 20 μL
NBP157049 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15704920 Supplier Novus Biologicals Supplier No. NBP15704920UL

Description

Rabbit Polyclonal Antibody

ZDHHC21 Polyclonal specifically detects ZDHHC21 in Human samples. It is validated for Western Blot.

Specifications

Antigen ZDHHC21
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias DHHC-21, DNZ1, EC 2.3.1, EC 2.3.1.-, HSPC097, probable palmitoyltransferase ZDHHC21, Zinc finger DHHC domain-containing protein 21, zinc finger, DHHC domain containing 21, zinc finger, DHHC-type containing 21,9130404H11Rik
Gene Symbols ZDHHC21
Host Species Rabbit
Immunogen Synthetic peptides corresponding to ZDHHC21 (zinc finger, DHHC-type containing 21) The peptide sequence was selected from the middle region of ZDHHC21. Peptide sequence ELLTCYALMFSFCHYYYFLPLKKRNLDLFVFRHELAIMRLAAFMGITMLV.
Molecular Weight of Antigen 31 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 340481
Target Species Human, Primate
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.