ZDHHC7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP233884

Catalog No. NBP233884

Description

ZDHHC7 Polyclonal specifically detects ZDHHC7 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZDHHC7
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: Q9NXF8
• Gene Symbols: ZDHHC7
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SACTVKTGLDPTLVGICGEGTESVQSLLLGAVPKGNATKEYMESLQLKPGEVIYKCPKCC
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: EC 2.3.1, EC 2.3.1.-, FLJ10792, FLJ20279, palmitoyltransferase ZDHHC7, Sertoli cell gene with zinc finger domain- and #946, SERZ1, SERZ-B, Zinc finger DHHC domain-containing protein 7, Zinc finger protein 370, zinc finger, DHHC domain containing 7, zinc finger, DHHC-type containing 7, ZNF370DHHC-7
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55625
• Target Species: Human
• Isotype: IgG

For Research Use Only