Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZEB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP18884525UL
Description
ZEB1 Polyclonal antibody specifically detects ZEB1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), ChIP assay.Specifications
ZEB1 | |
Polyclonal | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
AREB6MGC133261, delta-crystallin enhancer binding factor 1, DELTAEF1, FECD6, Negative regulator of IL2, NIL2A, NIL-2-A, NIL-2-A zinc finger protein, posterior polymorphous corneal dystrophy 3, PPCD3, TCF-8, TCF8BZP, Transcription factor 8, transcription factor 8 (represses interleukin 2 expression), ZEB, Zfhep, ZFHX1A, zinc finger E-box binding homeobox 1, zinc finger E-box-binding homeobox 1, zinc finger homeodomain enhancer-binding protein | |
Rabbit | |
124 kDa | |
25 μL | |
Cancer, Chromatin Research, Signal Transduction, Transcription Factors and Regulators, Zinc Finger | |
6935 | |
Human, Mouse | |
IgG |
ChIP Assay, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
0.2 mg/mL | |
Western Blot 0.04-0.4 ug/mL, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000, Chromatin Immunoprecipitation Sequencing | |
P37275 | |
ZEB1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction