Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZEB1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$416.50 - $682.00

Specifications

Antigen	ZEB1
Concentration	0.2 mg/mL
Applications	ChIP Assay, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB405932 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP18884525UL	25 μL	Each for $416.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP188845 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP188845	0.1 mL	Each for $682.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ZEB1 Polyclonal antibody specifically detects ZEB1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), ChIP assay.

Specifications

Antigen	ZEB1
Applications	ChIP Assay, Immunocytochemistry, Immunofluorescence, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human, Mouse
Gene Accession No.	P37275
Gene ID (Entrez)	6935
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:EAEKPESSVSSATGDGNLSPSQPPLKNLLSLLKAYYALNAQPSAEELSKIADSVNLPLDVVKKWFEKMQAGQISVQSSEPSSPEPGKVNIPAKNNDQPQSANANEPQDSTVNLQSPLKMTNSPVLPVGST
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Molecular Weight of Antigen	124 kDa

Concentration	0.2 mg/mL
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Cancer, Chromatin Research, Signal Transduction, Transcription Factors and Regulators, Zinc Finger
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	AREB6MGC133261, delta-crystallin enhancer binding factor 1, DELTAEF1, FECD6, Negative regulator of IL2, NIL2A, NIL-2-A, NIL-2-A zinc finger protein, posterior polymorphous corneal dystrophy 3, PPCD3, TCF-8, TCF8BZP, Transcription factor 8, transcription factor 8 (represses interleukin 2 expression), ZEB, Zfhep, ZFHX1A, zinc finger E-box binding homeobox 1, zinc finger E-box-binding homeobox 1, zinc finger homeodomain enhancer-binding protein
Gene Symbols	ZEB1
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ZEB1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents