Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZEB2 Antibody, Novus Biologicals™
SDP

Catalog No. NB406975 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB406975 25 μL
NBP182991 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB406975 Supplier Novus Biologicals Supplier No. NBP18299125UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody has been used in 17 publications

ZEB2 Polyclonal specifically detects ZEB2 in Human, Mouse samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.

Specifications

Antigen ZEB2
Applications Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.04 - 0.4 ug/ml, Flow Cytometry, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias KIAA0569FLJ42816, SIP1HSPC082, Smad-interacting protein 1, SMADIP1ZFHX1BSIP-1, ZFX1B, zinc finger E-box binding homeobox 2, zinc finger E-box-binding homeobox 2, zinc finger homeobox 1b, Zinc finger homeobox protein 1b
Gene Symbols ZEB2
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE
Purification Method Affinity Purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline Core ESC Like Genes, Neuroscience, Stem Cell Markers
Primary or Secondary Primary
Gene ID (Entrez) 9839
Test Specificity Specificity of human ZEB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human, Mouse
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.