Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZEB2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 17 publications
$416.50 - $706.00
Specifications
Antigen | ZEB2 |
---|---|
Dilution | Western Blot 0.04 - 0.4 ug/ml, Flow Cytometry, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated |
Applications | Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ZEB2 Polyclonal specifically detects ZEB2 in Human, Mouse samples. It is validated for Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin, Knockdown Validated.Specifications
ZEB2 | |
Western Blot, Flow Cytometry, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin), KnockDown | |
Unconjugated | |
RUO | |
Human, Mouse | |
KIAA0569FLJ42816, SIP1HSPC082, Smad-interacting protein 1, SMADIP1ZFHX1BSIP-1, ZFX1B, zinc finger E-box binding homeobox 2, zinc finger E-box-binding homeobox 2, zinc finger homeobox 1b, Zinc finger homeobox protein 1b | |
ZEB2 | |
IgG | |
Affinity Purified | |
Specificity of human ZEB2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.04 - 0.4 ug/ml, Flow Cytometry, Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000, Knockdown Validated | |
Polyclonal | |
Rabbit | |
Core ESC Like Genes, Neuroscience, Stem Cell Markers | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
9839 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:SPVKPMDSITSPSIAELHNSVTNCDPPLRLTKPSHFTNIKPVEKLDHSRSNTPSPLNLSSTSSKNSHSSSYTPNSFSSEELQAEPLDLSLPKQMKEPKSIIATKNKTKASSISLDHNSVSSSSE | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title