Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZFHX2 Antibody, Novus Biologicals™

ZFHX2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17999820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17999820 20 μL
NBP179998 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17999820 Supplier Novus Biologicals Supplier No. NBP17999820UL

Description

Rabbit Polyclonal Antibody

ZFHX2 Polyclonal specifically detects ZFHX2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen ZFHX2
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. XP_375065
Gene Alias KIAA1762, MGC141820, zinc finger homeobox 2, zinc finger homeodomain protein 2, zinc finger protein 409
Gene Symbols ZFHX2
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human ZNF409. Peptide sequence GGQGSPPEASLPPSAGDKEPKTKSSWQCKVCSYETNISRNLRIHMTSEKH.
Molecular Weight of Antigen 92 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 85446
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.