missing translation for 'onlineSavingsMsg'
Learn More
Learn More
ZFHX2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$204.00 - $482.50
Specifications
| Antigen | ZFHX2 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17999820
|
Novus Biologicals
NBP17999820UL |
20 μL |
Each for $204.00
|
|
|||||
|
NBP179998
|
Novus Biologicals
NBP179998 |
100 μL |
Each for $482.50
|
|
|||||
Description
ZFHX2 Polyclonal specifically detects ZFHX2 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ZFHX2 | |
| Polyclonal | |
| Rabbit | |
| XP_375065 | |
| 85446 | |
| Synthetic peptide directed towards the middle region of human ZNF409. Peptide sequence GGQGSPPEASLPPSAGDKEPKTKSSWQCKVCSYETNISRNLRIHMTSEKH. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| KIAA1762, MGC141820, zinc finger homeobox 2, zinc finger homeodomain protein 2, zinc finger protein 409 | |
| ZFHX2 | |
| IgG | |
| 92 kDa |
Spot an opportunity for improvement?
missing translation for 'provideContentCorrection'
missing translation for 'provideContentCorrection'
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
missing translation for 'productTitle'