Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZFP3 Antibody, Novus Biologicals™
SDP

Catalog No. NB18017720 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB18017720 20 μL
NBP180171 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB18017720 Supplier Novus Biologicals Supplier No. NBP18017120UL

Rabbit Polyclonal Antibody

ZFP3 Polyclonal specifically detects ZFP3 in Human samples. It is validated for Western Blot.

Specifications

Antigen ZFP3
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS & 2% Sucrose. with No Preservative
Gene Accession No. NP_694563
Gene Alias MRX89MGC8941, zinc finger protein 41
Gene Symbols ZFP3
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human ZFP3. Peptide sequence TTEGVSAFATSGQNFLEILESNKTQRSSVGEKPHTCKECGKAFNQNSHLI.
Molecular Weight of Antigen 58 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 124961
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.