Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZFYVE1 Antibody, Novus Biologicals™

ZFYVE1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP179426 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP179426 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP179426 Supplier Novus Biologicals Supplier No. NBP179426
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ZFYVE1 Polyclonal specifically detects ZFYVE1 in Human samples. It is validated for Western Blot.

Specifications

Antigen ZFYVE1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_848535
Gene Alias DFCP1, DFCP1phosphoinositide-binding protein SR3, Double FYVE-containing protein 1, KIAA1589tandem FYVE fingers-1 protein, SR3, TAFF1zinc finger FYVE domain-containing protein 1, Tandem FYVE fingers-1, zinc finger protein, subfamily 2A (FYVE domain containing), 1, zinc finger, FYVE domain containing 1, ZNFN2A1zinc finger protein, subfamily 2A, member 1
Gene Symbols ZFYVE1
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human ZFYVE1The immunogen for this antibody is ZFYVE1. Peptide sequence GVPHEAKSRCRYSHQYDNRVYTCKACYERGEEVSVVPKTSASTDSPWMGL.
Molecular Weight of Antigen 40 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 53349
Test Specificity Expected identity based on immunogen sequence: Xenopus: 78%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.