ZFYVE27 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159421

Catalog No. NBP159421

Description

ZFYVE27 Polyclonal specifically detects ZFYVE27 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZFYVE27
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ32919, PROTRUDIN, RP11-459F3.2, SPG33, zinc finger FYVE domain-containing protein 27, zinc finger, FYVE domain containing 27
• Host Species: Rabbit
• Molecular Weight of Antigen: 46 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q5T4F4
• Gene Symbols: ZFYVE27
• Immunogen: Synthetic peptides corresponding to ZFYVE27(zinc finger, FYVE domain containing 27) The peptide sequence was selected from the C terminal of ZFYVE27 (NP_001002261). Peptide sequence TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 118813
• Reconstitution: Reconstitute in 100μL distilled water to a final antibody concentration of 1mg/mL.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG