Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZFYVE27 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZFYVE27 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
ZFYVE27 Polyclonal specifically detects ZFYVE27 in Human samples. It is validated for Western Blot.Specifications
ZFYVE27 | |
Polyclonal | |
Purified | |
RUO | |
FLJ32919, PROTRUDIN, RP11-459F3.2, SPG33, zinc finger FYVE domain-containing protein 27, zinc finger, FYVE domain containing 27 | |
ZFYVE27 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
Q5T4F4 | |
118813 | |
Synthetic peptides corresponding to ZFYVE27(zinc finger, FYVE domain containing 27) The peptide sequence was selected from the C terminal of ZFYVE27 (NP_001002261). Peptide sequence TFSVLKKRRSCSNCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASC. | |
Primary | |
46 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title