ZFYVE9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25752125UL

Catalog No. NB403444

Description

ZFYVE9 Polyclonal specifically detects ZFYVE9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ZFYVE9
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 μg/mL
• Gene Alias: Madh-interacting protein, MADHIP, mothers against decapentaplegic homolog interacting protein, mothers against decapentaplegic homolog interacting protein, receptoractivation anchor, NSP, receptor activation anchor, SARAhSARA, Smad anchor for receptor activation, SMADIPMAD, mothers against decapentaplegic homolog (Drosophila) interacting protein, zinc finger FYVE domain-containing protein 9, zinc finger, FYVE domain containing 9
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ZFYVE9
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDSYGMQDPGVSFVPKTLPSKEDSVTEEKEIEESKSECYSN
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 9372
• Target Species: Human
• Form: Purified

For Research Use Only