Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZFYVE9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | ZFYVE9 |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZFYVE9 Polyclonal specifically detects ZFYVE9 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
ZFYVE9 | |
Polyclonal | |
Rabbit | |
Signal Transduction | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
9372 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QPEDTNGDSGGQCVGLADAGLDLKGTCISESEECDFSTVIDTPAANYLSNGCDSYGMQDPGVSFVPKTLPSKEDSVTEEKEIEESKSECYSN | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
Human | |
Madh-interacting protein, MADHIP, mothers against decapentaplegic homolog interacting protein, mothers against decapentaplegic homolog interacting protein, receptoractivation anchor, NSP, receptor activation anchor, SARAhSARA, Smad anchor for receptor activation, SMADIPMAD, mothers against decapentaplegic homolog (Drosophila) interacting protein, zinc finger FYVE domain-containing protein 9, zinc finger, FYVE domain containing 9 | |
ZFYVE9 | |
IgG | |
Affinity Purified |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title