Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZG16 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$208.00 - $487.50
Specifications
| Antigen | ZG16 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15800720
|
Novus Biologicals
NBP15800720UL |
20 μL |
Each for $208.00
|
|
|||||
|
NBP158007
|
Novus Biologicals
NBP158007 |
100 μL |
Each for $487.50
|
|
|||||
Description
ZG16 Polyclonal specifically detects ZG16 in Human samples. It is validated for Western Blot.Specifications
| ZG16 | |
| Polyclonal | |
| Rabbit | |
| O60844 | |
| 653808 | |
| Synthetic peptides corresponding to ZG16(zymogen granule protein 16) The peptide sequence was selected from the middle region of ZG16. Peptide sequence WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| hZG16, JCLN, JCLN1, MGC34820, ZG16A | |
| ZG16 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title