Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZG16 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15800720UL
Description
ZG16 Polyclonal specifically detects ZG16 in Human samples. It is validated for Western Blot.Specifications
ZG16 | |
Polyclonal | |
Western Blot 1:100-1:2000 | |
O60844 | |
ZG16 | |
Synthetic peptides corresponding to ZG16(zymogen granule protein 16) The peptide sequence was selected from the middle region of ZG16. Peptide sequence WSDYVGGRNGDLEEIFLHPGESVIQVSGKYKWYLKKLVFVTDKGRYLSFG. | |
20 μL | |
Primary | |
Human | |
IgG |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
hZG16, JCLN, JCLN1, MGC34820, ZG16A | |
Rabbit | |
Affinity Purified | |
RUO | |
653808 | |
Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction