Zinc finger protein 395 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP317459100UL

Catalog No. NB169993

Description

Zinc finger protein 395 Polyclonal antibody specifically detects Zinc finger protein 395 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Zinc finger protein 395
• Classification: Polyclonal
• Dilution: Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: dJ874C20.2, FLJ23407, zinc finger protein 310 pseudogene, zinc finger protein 323, ZNF20-Lp, ZNF310P
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: WPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAA
• Quantity: 100 μg
• Research Discipline: DNA Repair, DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 55893
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified