Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Zinc finger protein 395 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$366.50 - $607.50
Specifications
| Antigen | Zinc finger protein 395 |
|---|---|
| Dilution | Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 |
| Applications | Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
Zinc finger protein 395 Polyclonal antibody specifically detects Zinc finger protein 395 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)Specifications
| Zinc finger protein 395 | |
| Western Blot, Immunohistochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| DNA Repair, DNA replication Transcription Translation and Splicing | |
| PBS, pH 7.2, 40% glycerol | |
| 55893 | |
| IgG | |
| Affinity purified |
| Western Blot 0.04 to 0.4 μg/mL, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
| Polyclonal | |
| Purified | |
| RUO | |
| Human | |
| dJ874C20.2, FLJ23407, zinc finger protein 310 pseudogene, zinc finger protein 323, ZNF20-Lp, ZNF310P | |
| This antibody was developed against Recombinant Protein corresponding to amino acids: WPNCGKVLRSIVGIKRHVKALHLGDTVDSDQFKREEDFYYTEVQLKEESAA | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title