Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZKSCAN3 Antibody, Novus Biologicals™
SDP

Catalog No. NB392913 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392913 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB392913 Supplier Novus Biologicals Supplier No. NBP26875625UL
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

ZKSCAN3 Polyclonal specifically detects ZKSCAN3 in Human samples. It is validated for ChIP Assay-exo-Seq, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen ZKSCAN3
Applications ChIP Assay-exo-Seq, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias dJ874C20.1, FLJ33906, ZF47, Zfp47, Zfp-47, Zinc finger and SCAN domain-containing protein 13, Zinc finger protein 306KIAA0426, Zinc finger protein 309ZNF306ZFP306, Zinc finger protein 47 homolog, zinc finger protein with KRAB and SCAN domains 3, zinc finger protein zfp47, zinc finger with KRAB and SCAN domains 3, ZNF309, ZSCAN13
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: AQSTEDQMELLVIKVEEEEAGFPSSPDLGSEGS
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 80317
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.