Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZMYM3 Antibody, Novus Biologicals™

ZMYM3 Antibody, Novus Biologicals™
SDP

Catalog No. NB392789 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB392789 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB392789 Supplier Novus Biologicals Supplier No. NBP26900425UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ZMYM3 Polyclonal antibody specifically detects ZMYM3 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen ZMYM3
Applications Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL
Formulation PBS (pH 7.2) and 40% Glycerol
Gene Alias DXS6673EZinc finger protein 261KIAA0385XFIM, MYM, zinc finger, MYM-type 3, ZNF198L2, ZNF261zinc finger MYM-type protein 3
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MDPSDFPSPFDPLTLPEKPLAGDLPVDMEFGEDLLESQTAPTRGWAPPGPSPSSGALDLLDTPAGLEKDPGVLDGATE
Purification Method Protein A purified
Quantity 25 μL
Regulatory Status RUO
Research Discipline DNA Repair
Primary or Secondary Primary
Gene ID (Entrez) 9203
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.